neutrophil-peptide-1 Human Neutrophil Peptide-1 (HNP-1) is a significant alpha-defensin produced by neutrophils, playing a crucial role in the innate immune system. Its potent antimicrobial and cytotoxic activities make it a subject of interest for scientific research and potential therapeutic applications. For researchers and institutions looking to acquire HNP-1, understanding its properties and available purchasing options is essential.
HNP-1 is one of the primary human neutrophil peptides, belonging to the alpha-defensin family.Human Neutrophil Peptide-1 (NP-1/HNNP-1) ELISA Kit, 96 ... These peptides are stored in the azurophilic granules of neutrophils and are released upon activation of these immune cells. HNP-1 exhibits a broad spectrum of antimicrobial activity against Gram-positive and Gram-negative bacteria, as well as fungi and some viruses. Beyond its direct antimicrobial effects, HNP-1 also possesses cytotoxic properties and can influence various cellular processes, including endothelial cell function and nerve regeneration.Humanneutrophil peptide 1-3,HNP1-3 ELISA Kit For research use only. Not for use in diagnostic procedures.For general protocol and instruction, please click ... Its involvement in the innate immune response makes it a valuable research tool for studying infection, inflammation, and autoimmune diseases.Peptide Human Neutrophil Elastase Inhibitors from Natural ...
The multifaceted nature of HNP-1 lends itself to a variety of research applications. Its antimicrobial properties are investigated in the context of developing new antibiotics and understanding bacterial resistance mechanismsHNP - 1, Defensin HumanNeutrophil Peptide-1. ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29) · Price: 4.00 · Available Options.. Researchers are also exploring its potential as an immunotherapeutic agent, particularly in combating infections that are challenging to treat with conventional methods.
Furthermore, HNP-1 has been implicated in the development of atherosclerosis and plays a role in allergic asthma and autoimmune conditions, making it a target for research in these areasMammalian defensins are abundant in the cytoplasmic azurophilic granules ofneutrophils, Paneth cells of the small intestine and some macrophages.. Its ability to promote nerve regeneration is also a burgeoning field of study, suggesting potential applications in treating nerve injuries...peptideC-Reactive Protein (CRP)Calcium (adjusted)Cardiovascular Risk ...1week ago. Highly Recommend. Highly recommend Randox Health. The services are .... The development of HNP1 ELISA kits also points to its utility in diagnostic research for conditions where neutrophil activity is a key indicator.
When seeking to buy neutrophil peptide-1, several factors are important to consider to ensure the quality and suitability of the product for your specific research needs作者：F Yu·2022·被引用次数：9—Neutrophil peptide-1promotes the repair of sciatic nerve injury through the expression of proteins related to nerve regeneration · Full Article ....
* Purity and Formulation: HNP-1 is typically available in various forms, such as lyophilized powder, often as a trifluoroacetate salt.Brain natriureticpeptide, NT-proBNP, N terminal pro B type natriureticpeptide, natriureticpeptides· Breast Cancer Gene1and Breast Cancer Gene 2 · Breast ... It is crucial to check the purity specifications provided by the supplier.Functional Interaction of Human Neutrophil Peptide-1 with ... High purity is generally preferred for research purposes to avoid confounding results.Tests Index
* Quantity and Concentration: Suppliers offer HNP-1 in different quantities, ranging from milligrams to smaller research-sized amounts.Human Neutrophil Peptide-1 (NP-1/HNNP-1) ELISA Kit, 96 ... The concentration of the peptide in stock solutions or the final product should also be clearly stated.
* Supplier Reputation: Purchasing from reputable scientific supply companies is paramount. Look for suppliers with a history of providing high-quality research reagents and good customer support.作者：F Yu·2022·被引用次数：9—Neutrophil peptide-1promotes the repair of sciatic nerve injury through the expression of proteins related to nerve regeneration · Full Article ... Companies like Merck and Bachem are often cited for their offerings in this area.
* Research Grade vs. Diagnostic Use: It's important to distinguish between products intended for general research and those specifically designed for diagnostic procedures. While HNP-1 is studied for diagnostic adjunctive roles, the purchased peptide is typically for experimental use. ELISA kits are a common format for quantitative measurement in research settings.
* Storage and Handling: Proper storage conditions are vital for maintaining the stability and activity of HNP-1Functional Interaction of Human Neutrophil Peptide-1 with .... Suppliers usually provide detailed instructions on how to store the peptide, typically requiring cold temperatures and protection from moisture.Proteolysis of human C-reactive protein by neutrophil-derived ...
Several scientific supply companies offer Human Neutrophil Peptide-1 for purchase. These include major chemical and biological reagent providers. When searching for "neutrophil peptide-1 buy," you will find listings from companies that specialize in peptides, antibodies, and immunoassay kits.作者：R Gandotra·2022·被引用次数：17—However, up to 40% of culture-negative PJI needs other surrogate biomarkers such as humanneutrophil peptide 1(HNP 1) to improve diagnostic ... These platforms often provide detailed product information, including chemical properties, relevant research citations, and pricingHuman Neutrophil Peptide-1 (NP-1/HNNP-1) ELISA Kit, 96 .... For example, specific listings mention HNP-1, also known as alpha-Defensin-1, with varying quantities and catalog numbers. Researchers can also find related products such as HNP1-3 ELISA kits, which are designed for the quantitative detection of these neutrophil peptides in biological samplesHuman Neutrophil Peptide-1 (NP-1/HNNP-1) ELISA Kit, 96 ....
Join the newsletter to receive news, updates, new products and freebies in your inbox.